PDB entry 2ch2

View 2ch2 on RCSB PDB site
Description: Structure of the Anopheles gambiae 3-hydroxykynurenine transaminase in complex with inhibitor
Class: transferase
Keywords: plp-enzyme, kynurenine pathway, transferase
Deposited on 2006-03-10, released 2006-03-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.214
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxykynurenine transaminase
    Species: ANOPHELES GAMBIAE [TaxId:7165]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ch2a_
  • Chain 'B':
    Compound: 3-hydroxykynurenine transaminase
    Species: ANOPHELES GAMBIAE [TaxId:7165]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ch2b_
  • Chain 'C':
    Compound: 3-hydroxykynurenine transaminase
    Species: ANOPHELES GAMBIAE [TaxId:7165]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ch2c_
  • Chain 'D':
    Compound: 3-hydroxykynurenine transaminase
    Species: ANOPHELES GAMBIAE [TaxId:7165]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ch2d_
  • Heterogens: PLP, KY1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ch2A (A:)
    mkftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdgl
    ryifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvr
    tiegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivda
    vaslcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdl
    lllgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgk
    mgldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgim
    gecstvqkiqfylygfkeslkathpdyifeesngfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ch2A (A:)
    ftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglry
    ifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrti
    egppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdava
    slcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdlll
    lgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkmg
    ldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimge
    cstvqkiqfylygfkeslkathpdyif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ch2B (B:)
    mkftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdgl
    ryifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvr
    tiegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivda
    vaslcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdl
    lllgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgk
    mgldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgim
    gecstvqkiqfylygfkeslkathpdyifeesngfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ch2B (B:)
    ftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglry
    ifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrti
    egppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdava
    slcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdlll
    lgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkmg
    ldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimge
    cstvqkiqfylygfkeslkathpdyif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ch2C (C:)
    mkftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdgl
    ryifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvr
    tiegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivda
    vaslcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdl
    lllgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgk
    mgldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgim
    gecstvqkiqfylygfkeslkathpdyifeesngfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ch2C (C:)
    ftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglry
    ifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrti
    egppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdava
    slcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdlll
    lgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkmg
    ldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimge
    cstvqkiqfylygfkeslkathpdyif
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ch2D (D:)
    mkftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdgl
    ryifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvr
    tiegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivda
    vaslcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdl
    lllgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgk
    mgldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgim
    gecstvqkiqfylygfkeslkathpdyifeesngfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ch2D (D:)
    ftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglry
    ifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrti
    egppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdava
    slcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdlll
    lgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkmg
    ldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimge
    cstvqkiqfylygfkeslkathpdyif