PDB entry 2cgo

View 2cgo on RCSB PDB site
Description: factor inhibiting hif-1 alpha with fumarate
Class: oxidoreductase
Keywords: 2-oxoglutarate, acetylation, activator, alternative splicing, asparaginyl hydroxylase, DNA-binding, dsbh, fi, hif, hydroxylation, hypoxia, nuclear protein, oxygenase, phosphorylation, polymorphism, s-nitrosylation, transcription, transcription activator/inhibitor, transcription regulation, dioxygenase, iron, metal-binding, oxidoreductase
Deposited on 2006-03-09, released 2006-12-13
The last revision prior to the SCOP 1.75 freeze date was dated 2007-02-06, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxia-inducible factor 1 alpha inhibitor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2cgoa1
  • Heterogens: FE, SO4, FMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cgoA (A:)
    maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
    pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
    eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
    qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqs
    qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
    ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cgoA (A:)
    avasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdt
    nlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfknreemkfhefve
    klqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnlllig
    megnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdye
    rfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieypl
    kahqkvaimrniekmlgealgnpqevgpllntmikgryn