PDB entry 2cgf

View 2cgf on RCSB PDB site
Description: a radicicol analogue bound to the ATP binding site of the n-terminal domain of the yeast hsp90 chaperone
Class: chaperone
Keywords: ATP-binding, chaperone, heat shock, inhibitor, multigene family
Deposited on 2006-03-02, released 2006-11-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent molecular chaperone hsp82
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CGF
      • conflict (206)
    • Uniprot P02829
    Domains in SCOPe 2.06: d2cgfa1, d2cgfa2
  • Heterogens: P2N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cgfA (A:)
    mrgshhhhhhgmasetfefqaeitqlmsliintvysnkeiflrelisnasdaldkiryks
    lsdpkqletepdlfiritpkpeqkvleirdsgigmtkaelinnlgtiaksgtkafmeals
    agadvsmigqfgvgfyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigr
    gtilrlflkddqleyleekrikevikkhsefvaypiqlvvtkeve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cgfA (A:)
    asetfefqaeitqlmsliintvysnkeiflrelisnasdaldkirykslsdpkqletepd
    lfiritpkpeqkvleirdsgigmtkaelinnlgtiaksgtkafmealsagadvsmigqfg
    vgfyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigrgtilrlflkddq
    leyleekrikevikkhsefvaypiqlvvtkev