PDB entry 2cg7

View 2cg7 on RCSB PDB site
Description: second and third fibronectin type I module pair (crystal form II).
Class: signaling protein
Keywords: signaling protein, fibronectin, 2f13f1, acute phase, alternative splicing, cell adhesion, glycoprotein, heparin-binding, phosphorylation, pyrrolidone carboxylic acid, sulfation
Deposited on 2006-02-27, released 2007-02-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.19
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2cg7a1, d2cg7a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cg7A (A:)
    aeetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctianrcheggqsykigd
    twrrphetggymlecvclgngkgewtckpi