PDB entry 2cg6

View 2cg6 on RCSB PDB site
Description: second and third fibronectin type I module pair (crystal form I).
Class: signaling protein
Keywords: cell adhesion, glycoprotein, heparin-binding, signaling protein, acute phase, alternative splicing, phosphorylation, pyrrolidone carboxylic acid, sulfation
Deposited on 2006-02-27, released 2007-02-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.191
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human fibronectin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2cg6a1, d2cg6a2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cg6A (A:)
    aeetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctianrcheggqsykigd
    twrrphetggymlecvclgngkgewtckpi