PDB entry 2cfx

View 2cfx on RCSB PDB site
Description: structure of b.subtilis lrpc
Class: transcription
Keywords: transcription, lrpc, transcriptional regulation, DNA binding, ffrp
Deposited on 2006-02-24, released 2006-03-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hth-type transcriptional regulator lrpc
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cfxa1, d2cfxa2
  • Chain 'B':
    Compound: hth-type transcriptional regulator lrpc
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cfxb1, d2cfxb2
  • Chain 'C':
    Compound: hth-type transcriptional regulator lrpc
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cfxc1, d2cfxc2
  • Chain 'D':
    Compound: hth-type transcriptional regulator lrpc
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cfxd1, d2cfxd2
  • Chain 'E':
    Compound: hth-type transcriptional regulator lrpc
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cfxe1, d2cfxe2
  • Chain 'F':
    Compound: hth-type transcriptional regulator lrpc
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cfxf1, d2cfxf2
  • Chain 'G':
    Compound: hth-type transcriptional regulator lrpc
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cfxg1, d2cfxg2
  • Chain 'H':
    Compound: hth-type transcriptional regulator lrpc
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cfxh1, d2cfxh2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cfxA (A:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtkngrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cfxA (A:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cfxB (B:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtkngrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cfxB (B:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cfxC (C:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtkngrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cfxC (C:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cfxD (D:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtkngrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cfxD (D:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2cfxE (E:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtkngrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cfxE (E:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2cfxF (F:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtkngrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cfxF (F:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2cfxG (G:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtkngrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cfxG (G:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2cfxH (H:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtkngrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cfxH (H:)
    mkldqidlniieelkkdsrlsmrelgrkiklsppsvtervrqlesfgiikqytlevdqkk
    lglpvsciveatvknadyerfksyiqtlpniefcyriagaacymlkinaesleavedfin
    ktspyaqtvthvifseidtk