PDB entry 2cfr

View 2cfr on RCSB PDB site
Description: crystal structure of human pyridoxal 5'-phosphate phosphatase
Class: hydrolase
Keywords: phosphatase, chronophin, had family, hydrolase, magnesium, metal-binding, pyridoxal phosphate
Deposited on 2006-02-23, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyridoxal phosphate phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CFR
    • Uniprot Q96GD0 (Start-297)
    Domains in SCOPe 2.07: d2cfra_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cfrA (A:)
    gamarcerlrgaalrdvlgraqgvlfdcdgvlwngeravpgapellerlaragkaalfvs
    nnsrrarpelalrfarlgfgglraeqlfssalcaarllrqrlpgppdapgavfvlggegl
    raelraaglrlagdpsagdgaaprvravlvgydehfsfaklreacahlrdpecllvatdr
    dpwhplsdgsrtpgtgslaaavetasgrqalvvgkpspymfecitenfsidpartlmvgd
    rletdilfghrcgmttvltltgvsrleeaqaylaagqhdlvphyyvesiadltegled
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cfrA (A:)
    rcerlrgaalrdvlgraqgvlfdcdgvlwngeravpgapellerlaragkaalfvsnnsr
    rarpelalrfarlgfgglraeqlfssalcaarllrqrlpgppdapgavfvlggeglrael
    raaglrlagdpsaaprvravlvgydehfsfaklreacahlrdpecllvatdrdpwhplsd
    gsrtpgtgslaaavetasgrqalvvgkpspymfecitenfsidpartlmvgdrletdilf
    ghrcgmttvltltgvsrleeaqaylaagqhdlvphyyvesiadltegled