PDB entry 2cfk

View 2cfk on RCSB PDB site
Description: agao in complex with wc5 (ru-wire inhibitor, 5-carbon linker)
Class: oxidoreductase
Keywords: amine oxidase, arthrobacter globiformis, copper, copper containing, oxidoreductase, tpq, cuao, quinone, ruthenium diimine wires, competitive inhibition, metal-binding
Deposited on 2006-02-21, released 2007-05-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.146
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylethylamine oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cfka1, d2cfka2, d2cfka3
  • Heterogens: CU, NA, R5A, R5B, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cfkA (A:)
    pstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrv
    fihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkal
    aarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvv
    skevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewek
    wsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgey
    lvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsgi
    nytrrnrrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisql
    apglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltrese
    avreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlw
    vtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpim
    pvdtvgfklrpegffdrspvldvpanpsqsgshchgsnwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cfkA (A:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpimpvdtvg
    fklrpegffdrspvldvpan