PDB entry 2cfe

View 2cfe on RCSB PDB site
Description: the 1.5 a crystal structure of the malassezia sympodialis mala s 6 allergen, a member of the cyclophilin pan-allergen family
Class: immune system
Keywords: cyclophilin, malassezia sympodialis, allergen, ige, autoreactivity, immune system, epitope, fungi
Deposited on 2006-02-20, released 2006-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.143
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: allergen
  Species: MALASSEZIA SYMPODIALIS [TaxId:76777]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O93970 (0-161)
  Domains in SCOPe 2.07: d2cfea1
• Heterogens: ALA, PRO, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cfeA (A:)
  msnvffditkngaplgtikfklfddvvpktaanfralctgekgfgyagshfhrvipdfml
  qggdftagngtggksiygakfadenfqlkhnkpgllsmanagpntngsqffittvvtswl
  dgkhvvfgevidgmnvvkaieaegsgsgkprsrieiakcgvc