PDB entry 2cfe

View 2cfe on RCSB PDB site
Description: The 1.5 A crystal structure of the Malassezia sympodialis Mala s 6 allergen, a member of the cyclophilin pan-allergen family
Class: immune system
Keywords: cyclophilin, malassezia sympodialis, allergen, ige, autoreactivity, immune system, epitope, fungi
Deposited on 2006-02-20, released 2006-02-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: allergen
    Species: MALASSEZIA SYMPODIALIS [TaxId:76777]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cfea1
  • Heterogens: ALA, PRO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cfeA (A:)
    msnvffditkngaplgtikfklfddvvpktaanfralctgekgfgyagshfhrvipdfml
    qggdftagngtggksiygakfadenfqlkhnkpgllsmanagpntngsqffittvvtswl
    dgkhvvfgevidgmnvvkaieaegsgsgkprsrieiakcgvc