PDB entry 2cf2

View 2cf2 on RCSB PDB site
Description: architecture of mammalian fatty acid synthase
Class: transferase
Keywords: transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme
Deposited on 2006-02-14, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 4.3 Å
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid synthase, ks domain
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CF2 (192-240)
    Domains in SCOPe 2.07: d2cf2a1, d2cf2a2
  • Chain 'B':
    Compound: fatty acid synthase, mat domain
    Species: Sus scrofa [TaxId:9823]
  • Chain 'C':
    Compound: fatty acid synthase, dh domain
    Species: Sus scrofa [TaxId:9823]
    Domains in SCOPe 2.07: d2cf2c1
  • Chain 'D':
    Compound: fatty acid synthase, er domain
    Species: Sus scrofa [TaxId:9823]
  • Chain 'E':
    Compound: fatty acid synthase, kr domain
    Species: Sus scrofa [TaxId:9823]
    Domains in SCOPe 2.07: d2cf2e1
  • Chain 'J':
    Compound: fatty acid synthase, ks domain
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CF2 (192-240)
    Domains in SCOPe 2.07: d2cf2j1, d2cf2j2
  • Chain 'K':
    Compound: fatty acid synthase, mat domain
    Species: Sus scrofa [TaxId:9823]
  • Chain 'L':
    Compound: fatty acid synthase, dh domain
    Species: Sus scrofa [TaxId:9823]
    Domains in SCOPe 2.07: d2cf2l1
  • Chain 'M':
    Compound: fatty acid synthase, er domain
    Species: Sus scrofa [TaxId:9823]
  • Chain 'N':
    Compound: fatty acid synthase, kr domain
    Species: Sus scrofa [TaxId:9823]
    Domains in SCOPe 2.07: d2cf2n1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cf2A (A:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissasatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cf2C (C:)
    vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
    npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
    akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsafvdkresytk
    edllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldinpdlwffgc
    hfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlptakkvtyrih
    fkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cf2E (E:)
    mnfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnv
    tdpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlska
    vmrammkkrhgriitiggqanyaaakagligfskslarevasrgitvnvvapgfietsdd
    qragilaqvpagrlggaqeianavaflasdeaayitgetlhvnggm
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cf2J (J:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissasatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cf2L (L:)
    vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
    npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
    akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsafvdkresytk
    edllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldinpdlwffgc
    hfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlptakkvtyrih
    fkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cf2N (N:)
    mnfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnv
    tdpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlska
    vmrammkkrhgriitiggqanyaaakagligfskslarevasrgitvnvvapgfietsdd
    qragilaqvpagrlggaqeianavaflasdeaayitgetlhvnggm