PDB entry 2cer

View 2cer on RCSB PDB site
Description: beta-glycosidase from sulfolobus solfataricus in complex with phenethyl-substituted glucoimidazole
Class: hydrolase
Keywords: glycoside hydrolase, inhibitor, transition state mimic, family 1, glucoimidazole, hydrolase
Deposited on 2006-02-10, released 2006-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.193
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosidase a
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cera_
  • Chain 'B':
    Compound: beta-glucosidase a
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cerb_
  • Heterogens: PGI, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cerA (A:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
    vppvkplrh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cerB (B:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
    vppvkplrh