PDB entry 2cep

View 2cep on RCSB PDB site
Description: role of met-230 in intramolecular electron transfer between the oxyferryl heme and trp 191 in cytochrome c peroxidase compound ii
Deposited on 1994-05-31, released 1994-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.167
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d2cep__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >2cep_ (-)
    mittplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwd
    khdntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqe
    mqgpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalg
    kthlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgyimlptdysl
    iqdpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cep_ (-)
    tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhd
    ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
    pkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkth
    lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgyimlptdysliqd
    pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl