PDB entry 2cel

View 2cel on RCSB PDB site
Description: active-site mutant e212q determined at ph 6.0 with no ligand bound in the active site
Class: hydrolase
Keywords: cellulose degradation, hydrolase, glycosidase, glycoprotein
Deposited on 1996-08-24, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-beta-d-glucan cellobiohydrolase I
    Species: Hypocrea jecorina [TaxId:51453]
    Gene: CBH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62694 (1-433)
      • cloning artifact (93)
      • engineered (211)
    Domains in SCOPe 2.08: d2cela_
  • Chain 'B':
    Compound: 1,4-beta-d-glucan cellobiohydrolase I
    Species: Hypocrea jecorina [TaxId:51453]
    Gene: CBH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62694 (1-433)
      • cloning artifact (93)
      • engineered (211)
    Domains in SCOPe 2.08: d2celb_
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2celA (A:)
    esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
    cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
    tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
    kfingqanvegwepssnnantgigghgsccsqmdiweansisealtphpcttvgqeiceg
    dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
    nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
    vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
    ikfgpigstgnpsg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2celB (B:)
    esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
    cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
    tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
    kfingqanvegwepssnnantgigghgsccsqmdiweansisealtphpcttvgqeiceg
    dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
    nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
    vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
    ikfgpigstgnpsg