PDB entry 2ce9

View 2ce9 on RCSB PDB site
Description: a wrpw peptide bound to the groucho-tle wd40 domain.
Class: transcription regulation
Keywords: transcriptional co-repressor, wd40 domain, wnt signaling pathway, nuclear protein, phosphorylation, repressor, transcription, transcription regulation, wd repeat
Deposited on 2006-02-03, released 2006-06-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.181
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transducin-like enhancer protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE9 (0-8)
    • Uniprot Q04724 (9-336)
    Domains in SCOPe 2.05: d2ce9a_
  • Chain 'B':
    Compound: transducin-like enhancer protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE9 (0-8)
    • Uniprot Q04724 (9-336)
    Domains in SCOPe 2.05: d2ce9b_
  • Chain 'C':
    Compound: transducin-like enhancer protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE9 (0-8)
    • Uniprot Q04724 (9-336)
    Domains in SCOPe 2.05: d2ce9c_
  • Chain 'D':
    Compound: transducin-like enhancer protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE9 (0-8)
    • Uniprot Q04724 (9-336)
    Domains in SCOPe 2.05: d2ce9d_
  • Chain 'X':
    Compound: wrpw peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE9 (0-4)
  • Chain 'Y':
    Compound: wrpw peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE9 (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ce9A (A:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
    ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
    vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
    fqskesssvlscdisvddkyivtgsgdkkatvyeviy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ce9B (B:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
    ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
    vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
    fqskesssvlscdisvddkyivtgsgdkkatvyeviy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ce9C (C:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
    ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
    vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
    fqskesssvlscdisvddkyivtgsgdkkatvyeviy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ce9D (D:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
    ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
    vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
    fqskesssvlscdisvddkyivtgsgdkkatvyeviy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce9D (D:)
    dyfqgamgskpaysfhvmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrh
    vytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeastlsiwd
    laaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdg
    ascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmes
    snvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqske
    sssvlscdisvddkyivtgsgdkkatvyeviy
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.