PDB entry 2ce8

View 2ce8 on RCSB PDB site
Description: an eh1 peptide bound to the groucho-tle wd40 domain.
Class: transcription regulation
Keywords: transcriptional co-repressor, wd40 domain, wnt signaling pathway, nuclear protein, phosphorylation, repressor, transcription, transcription regulation, wd repeat
Deposited on 2006-02-03, released 2006-06-14
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-14, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.182
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transducin-like enhancer protein 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE8
    • Uniprot Q04724 (9-336)
    Domains in SCOP 1.75: d2ce8a1
  • Chain 'B':
    Compound: transducin-like enhancer protein 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE8
    • Uniprot Q04724 (9-336)
    Domains in SCOP 1.75: d2ce8b1
  • Chain 'C':
    Compound: transducin-like enhancer protein 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE8
    • Uniprot Q04724 (9-336)
    Domains in SCOP 1.75: d2ce8c1
  • Chain 'D':
    Compound: transducin-like enhancer protein 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE8
    • Uniprot Q04724 (9-336)
    Domains in SCOP 1.75: d2ce8d1
  • Chain 'X':
    Compound: eh1 peptide
  • Chain 'Y':
    Compound: eh1 peptide
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ce8A (A:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
    ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
    vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
    fqskesssvlscdisvddkyivtgsgdkkatvyeviy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ce8B (B:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
    ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
    vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
    fqskesssvlscdisvddkyivtgsgdkkatvyeviy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ce8C (C:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
    ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
    vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
    fqskesssvlscdisvddkyivtgsgdkkatvyeviy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ce8D (D:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
    ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
    vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
    fqskesssvlscdisvddkyivtgsgdkkatvyeviy
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.