PDB entry 2ce7

View 2ce7 on RCSB PDB site
Description: EDTA treated
Class: cell division protein
Keywords: cell division, metalloprotease, ftsh, cell division protein
Deposited on 2006-02-03, released 2006-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsh
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE7
      • engineered mutation (269)
    • Uniprot Q9WZ49
    Domains in SCOPe 2.08: d2ce7a1, d2ce7a2
  • Chain 'B':
    Compound: cell division protein ftsh
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE7
      • engineered mutation (269)
      • engineered mutation (264)
    • Uniprot Q9WZ49
    Domains in SCOPe 2.08: d2ce7b1, d2ce7b2
  • Chain 'C':
    Compound: cell division protein ftsh
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE7
      • engineered mutation (269)
    • Uniprot Q9WZ49
    Domains in SCOPe 2.08: d2ce7c1, d2ce7c2
  • Chain 'D':
    Compound: cell division protein ftsh
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE7
      • engineered mutation (269)
      • engineered mutation (264)
    • Uniprot Q9WZ49
    Domains in SCOPe 2.08: d2ce7d1, d2ce7d2
  • Chain 'E':
    Compound: cell division protein ftsh
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE7
      • engineered mutation (269)
      • engineered mutation (264)
    • Uniprot Q9WZ49
    Domains in SCOPe 2.08: d2ce7e1, d2ce7e2
  • Chain 'F':
    Compound: cell division protein ftsh
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE7
      • engineered mutation (269)
    • Uniprot Q9WZ49
    Domains in SCOPe 2.08: d2ce7f1, d2ce7f2
  • Heterogens: ZN, ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ce7A (A:)
    matmykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgt
    gktllaravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidav
    grhrgaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkk
    ivvdppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaareg
    rdkitmkdfeeaidrviagparksllispaekriiayheaghavvstvvpngepvhrisi
    iprgykalgytlhlpeedkylvsrnelldkltallggraaeevvfgdvtsgaandierat
    eiarnmvcqlgmseelgplawgkeeqevflgkeitrlrnyseevaskideevkkivtncy
    erakeiirkyrkqldniveilleketiegdelrrilseefekvveaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce7A (A:)
    ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
    laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhd
    ereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkk
    ileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeai
    drvilispaekriiayheaghavvstvvpngepvhrisiikylvsrnelldkltallggr
    aaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgklrnyseevaskidee
    vkkivtncyerakeiirkyrkqldniveilleketiegdelrrilse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ce7B (B:)
    matmykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgt
    gktllaravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidav
    grhrgaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkk
    ivvdppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaareg
    rdkitmkdfeeaidrviagparksllispaekriiayheaghavvstvvpngepvhrisi
    iprgykalgytlhlpeedkylvsrnelldkltallggraaeevvfgdvtsgaandierat
    eiarnmvcqlgmseelgplawgkeeqevflgkeitrlrnyseevaskideevkkivtncy
    erakeiirkyrkqldniveilleketiegdelrrilseefekvveaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce7B (B:)
    ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
    laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrde
    reqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkki
    leihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaid
    rviagpllispaekriiayheaghavvstvvpngepvhrisiiylvsrnelldkltallg
    graaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgklrnyseevaskid
    eevkkivtncyerakeiirkyrkqldniveilleketiegdelrrilseef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ce7C (C:)
    matmykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgt
    gktllaravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidav
    grhrgaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkk
    ivvdppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaareg
    rdkitmkdfeeaidrviagparksllispaekriiayheaghavvstvvpngepvhrisi
    iprgykalgytlhlpeedkylvsrnelldkltallggraaeevvfgdvtsgaandierat
    eiarnmvcqlgmseelgplawgkeeqevflgkeitrlrnyseevaskideevkkivtncy
    erakeiirkyrkqldniveilleketiegdelrrilseefekvveaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce7C (C:)
    ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
    laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgreq
    tlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkkilei
    htrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaidrvi
    lispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedkylvsrn
    elldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgrny
    seevaskideevkkivtncyerakeiirkyrkqldniveilleketiegdelrrilseef
    e
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ce7D (D:)
    matmykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgt
    gktllaravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidav
    grhrgaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkk
    ivvdppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaareg
    rdkitmkdfeeaidrviagparksllispaekriiayheaghavvstvvpngepvhrisi
    iprgykalgytlhlpeedkylvsrnelldkltallggraaeevvfgdvtsgaandierat
    eiarnmvcqlgmseelgplawgkeeqevflgkeitrlrnyseevaskideevkkivtncy
    erakeiirkyrkqldniveilleketiegdelrrilseefekvveaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce7D (D:)
    ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
    laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgere
    qtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkkile
    ihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaidrv
    iaksllispaekriiayheaghavvstvvpngepvhrisiiprgyylvsrnelldkltal
    lggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawglrnyseevaski
    deevkkivtncyerakeiirkyrkqldniveilleketiegdelrrilseefe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ce7E (E:)
    matmykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgt
    gktllaravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidav
    grhrgaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkk
    ivvdppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaareg
    rdkitmkdfeeaidrviagparksllispaekriiayheaghavvstvvpngepvhrisi
    iprgykalgytlhlpeedkylvsrnelldkltallggraaeevvfgdvtsgaandierat
    eiarnmvcqlgmseelgplawgkeeqevflgkeitrlrnyseevaskideevkkivtncy
    erakeiirkyrkqldniveilleketiegdelrrilseefekvveaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce7E (E:)
    psgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktlla
    ravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhere
    qtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkkile
    ihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaidrv
    iallispaekriiayheaghavvstvvpngepvhrisiikylvsrnelldkltallggra
    aeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgklrnyseevaskideev
    kkivtncyerakeiirkyrkqldniveilleketiegdelrrilse
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ce7F (F:)
    matmykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgt
    gktllaravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidav
    grhrgaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkk
    ivvdppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaareg
    rdkitmkdfeeaidrviagparksllispaekriiayheaghavvstvvpngepvhrisi
    iprgykalgytlhlpeedkylvsrnelldkltallggraaeevvfgdvtsgaandierat
    eiarnmvcqlgmseelgplawgkeeqevflgkeitrlrnyseevaskideevkkivtncy
    erakeiirkyrkqldniveilleketiegdelrrilseefekvveaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce7F (F:)
    ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
    laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrde
    reqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkki
    leihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaid
    rviispaekriiayheaghavvstvvpngepvhrisiiprgykalgylvsrnelldklta
    llggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgrnyseevaski
    deevkkivtncyerakeiirkyrkqldniveilleketiegdelrrilseef