PDB entry 2ce6

View 2ce6 on RCSB PDB site
Description: Structure of Helix Pomatia agglutinin with no ligands
Class: lectin
Keywords: lectin, snail, helix pomatia
Deposited on 2006-02-03, released 2006-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: helix pomatia agglutinin
    Species: HELIX POMATIA [TaxId:6536]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2F1K8 (0-End)
      • conflict (7)
      • conflict (10)
    Domains in SCOPe 2.08: d2ce6a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ce6A (A:)
rvqsgkincgddagwakvpsndpgrdntrelaknitfaspycrppvvllsitqldveqsq
nlrviarlysvsptgfkascytwhntkvysmsiswisieny

    Sequence, based on observed residues (ATOM records): (download) 
    >2ce6A (A:)
rvqsgkincgddagwakvpsndpgrdntrelaknitfaspycrppvvllsitqldveqsq
nlrviarlysvsptgfkascytwhntkvysmsiswisien