PDB entry 2ce3

View 2ce3 on RCSB PDB site
Description: crystal structure of the ATP-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis
Class: hydrolase
Keywords: serine protease, clp protease, proteolytic subunit, endopeptidase, mycobacterium tuberculosis, ATP-dependent protease, hydrolase
Deposited on 2006-02-03, released 2006-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.205
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ce3a_
  • Chain 'B':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ce3b_
  • Chain 'C':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ce3c_
  • Chain 'D':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ce3d_
  • Chain 'E':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ce3e_
  • Chain 'F':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ce3f_
  • Chain 'G':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ce3g_
  • Chain 'H':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ce3h_
  • Chain 'I':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ce3i_
  • Chain 'J':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ce3j_
  • Chain 'K':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ce3k_
  • Chain 'L':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ce3l_
  • Chain 'M':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ce3m_
  • Chain 'N':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ce3n_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ce3A (A:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce3A (A:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ce3B (B:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce3B (B:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ce3C (C:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce3C (C:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ce3D (D:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce3D (D:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ce3E (E:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce3E (E:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitra
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ce3F (F:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce3F (F:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ce3G (G:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce3G (G:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ce3H (H:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce3H (H:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ce3I (I:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce3I (I:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2ce3J (J:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce3J (J:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2ce3K (K:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce3K (K:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2ce3L (L:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce3L (L:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitra
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2ce3M (M:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce3M (M:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2ce3N (N:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce3N (N:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit