PDB entry 2ce1

View 2ce1 on RCSB PDB site
Description: structure of reduced arabidopsis thaliana cytochrome 6a
Class: electron transfer
Keywords: chloroplast, electron transport, heme, iron, thylakoid, photosynthesis, metal-binding, electron transfer
Deposited on 2006-02-02, released 2006-07-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.169
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c6
    Species: ARABIDOPSIS THALIANA [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93VA3
      • engineered mutation (16-17)
    Domains in SCOPe 2.08: d2ce1a_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ce1A (A:)
qtldiqrgatlfnracaachdtggniiqpgatlftkdlerngvdteeeiyrvtyfgkgrm
pgfgekctprgqctfgprlqdeeikllaefvkfqadqgwptvstd

    Sequence, based on observed residues (ATOM records): (download) 
    >2ce1A (A:)
ldiqrgatlfnracaachdtggniiqpgatlftkdlerngvdteeeiyrvtyfgkgrmpg
fgekctprgqctfgprlqdeeikllaefvkfqadqgwptv