PDB entry 2cdy

View 2cdy on RCSB PDB site
Description: manganese superoxide dismutase (mn-sod) from deinococcus radiodurans
Class: oxidoreductase
Keywords: manganese superoxide dismutase, deinococcus radiodurans, radiation resistance, oxidoreductase
Deposited on 2006-01-31, released 2006-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn]
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDY (Start-20)
    • Uniprot Q9RUV2 (21-230)
    Domains in SCOPe 2.07: d2cdya1, d2cdya2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn]
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDY (Start-20)
    • Uniprot Q9RUV2 (21-230)
    Domains in SCOPe 2.07: d2cdyb1, d2cdyb2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn]
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDY (Start-20)
    • Uniprot Q9RUV2 (21-230)
    Domains in SCOPe 2.07: d2cdyc1, d2cdyc2
  • Chain 'D':
    Compound: Superoxide dismutase [Mn]
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDY (Start-20)
    • Uniprot Q9RUV2 (21-230)
    Domains in SCOPe 2.07: d2cdyd1, d2cdyd2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cdyA (A:)
    msyyhhhhhhlestslykkalaytlpqlpyaydalephidartmeihhtkhhqtyvdnan
    kalegtefadlpveqliqqldrvpadkkgalrnnagghanhsmfwqimgqgqgqnganqp
    sgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmgea
    iagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cdyA (A:)
    alaytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqq
    ldrvpadkkgalrnnagghanhsmfwqimgqgqanqpsgelldainsafgsfdafkqkfe
    daaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayylny
    qnrrpdylaafwnvvnwdevskryaaak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cdyB (B:)
    msyyhhhhhhlestslykkalaytlpqlpyaydalephidartmeihhtkhhqtyvdnan
    kalegtefadlpveqliqqldrvpadkkgalrnnagghanhsmfwqimgqgqgqnganqp
    sgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmgea
    iagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cdyB (B:)
    alaytlpqlpyaydalephidartmeihhtkhhqtyvdnankaleefadlpveqliqqld
    rvpadkkgalrnnagghanhsmfwqimgqgqnqpsgelldainsafgsfdafkqkfedaa
    ktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayylnyqnr
    rpdylaafwnvvnwdevskryaaak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cdyC (C:)
    msyyhhhhhhlestslykkalaytlpqlpyaydalephidartmeihhtkhhqtyvdnan
    kalegtefadlpveqliqqldrvpadkkgalrnnagghanhsmfwqimgqgqgqnganqp
    sgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmgea
    iagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cdyC (C:)
    laytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqql
    drvpadkkgalrnnagghanhsmfwqimgqgqnganqpsgelldainsafgsfdafkqkf
    edaaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayyln
    yqnrrpdylaafwnvvnwdevskryaaak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cdyD (D:)
    msyyhhhhhhlestslykkalaytlpqlpyaydalephidartmeihhtkhhqtyvdnan
    kalegtefadlpveqliqqldrvpadkkgalrnnagghanhsmfwqimgqgqgqnganqp
    sgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmgea
    iagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cdyD (D:)
    laytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqql
    drvpadkkgalrnnagghanhsmfwqimgqgqanqpsgelldainsafgsfdafkqkfed
    aaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayylnyq
    nrrpdylaafwnvvnwdevskryaaak