PDB entry 2cdv

View 2cdv on RCSB PDB site
Description: refined structure of cytochrome c3 at 1.8 angstroms resolution
Deposited on 1983-11-15, released 1984-02-02
The last revision prior to the SCOP 1.55 freeze date was dated 1984-02-21, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d2cdv__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cdv_ (-)
  apkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkenyqkcatagchdnmdkkdk
  sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs