PDB entry 2cdv

View 2cdv on RCSB PDB site
Description: refined structure of cytochrome c3 at 1.8 angstroms resolution
Class: heme protein of electron transport
Keywords: heme protein of electron transport
Deposited on 1983-11-15, released 1984-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00132 (0-106)
      • conflict (41)
    Domains in SCOPe 2.08: d2cdva_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdvA (A:)
    apkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkenyqkcatagchdnmdkkdk
    sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs