PDB entry 2cdn

View 2cdn on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis adenylate kinase complexed with two molecules of ADP and mg
Class: transferase
Keywords: adenylate kinase, phosphoryl transfer, associative mechanism, ATP-binding, kinase, nucleotide biosynthesis, nucleotide-binding, transferase
Deposited on 2006-01-25, released 2006-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.172
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDN (Start-19)
    • Uniprot P69440 (20-200)
    Domains in SCOPe 2.07: d2cdna2, d2cdna3
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cdnA (A:)
    mgsshhhhhhssglvprgshmrvlllgppgagkgtqavklaeklgipqistgelfrrnie
    egtklgveakryldagdlvpsdltnelvddrlnnpdaangfildgyprsveqakalheml
    errgtdidavlefrvseevllerlkgrgraddtddvilnrmkvyrdetaplleyyrdqlk
    tvdavgtmdevfaralralgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cdnA (A:)
    prgshmrvlllgppgagkgtqavklaeklgipqistgelfrrnieegtklgveakrylda
    gdlvpsdltnelvddrlnnpdaangfildgyprsveqakalhemlerrgtdidavlefrv
    seevllerlkgrgraddtddvilnrmkvyrdetaplleyyrdqlktvdavgtmdevfara
    lralgk