PDB entry 2cdf

View 2cdf on RCSB PDB site
Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide-specific t cell receptors (tcr 5e)
Class: cell receptor
Keywords: cell receptor, cd1d, alpha-galactosylceramide, non-canonical tcr, tcr, t cell receptor, MHC class I, natural killer t cell, tcr 5e
Deposited on 2006-01-23, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.192
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tcr 5e
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDF (0-190)
    Domains in SCOPe 2.07: d2cdfa1, d2cdfa2
  • Chain 'B':
    Compound: tcr 5e
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDF (0-243)
    Domains in SCOPe 2.07: d2cdfb1, d2cdfb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdfA (A:)
    nqveqspqflsiqegenltvycnsssvfsslqwyrqepgegpvllvtvvtggevkklkrl
    tfqfgdarkdsslhitaaqpgdtglylcagadrgstlgrlyfgrgtqltvwpdiqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdfB (B:)
    eadiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdl
    ssestvsrirtehfpltlesarpshtsqylcassefrdgneklffgsgtqlsvledlnkv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad