PDB entry 2cde

View 2cde on RCSB PDB site
Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr
Class: cell receptor
Keywords: cell receptor, t cell receptor, tcr, natural killer t cell, cd1d, alpha- galactosylceramide, MHC class I
Deposited on 2006-01-23, released 2006-03-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.283
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inkt-tcr
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDE (0-End)
    Domains in SCOPe 2.05: d2cdea1, d2cdea2
  • Chain 'B':
    Compound: inkt-tcr
    Species: Homo sapiens [TaxId:9606]
    Domains in SCOPe 2.05: d2cdeb1, d2cdeb2
  • Chain 'C':
    Compound: inkt-tcr
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDE (0-End)
    Domains in SCOPe 2.05: d2cdec1, d2cdec2
  • Chain 'D':
    Compound: inkt-tcr
    Species: Homo sapiens [TaxId:9606]
    Domains in SCOPe 2.05: d2cded1, d2cded2
  • Chain 'E':
    Compound: inkt-tcr
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDE (0-End)
    Domains in SCOPe 2.05: d2cdee1, d2cdee2
  • Chain 'F':
    Compound: inkt-tcr
    Species: Homo sapiens [TaxId:9606]
    Domains in SCOPe 2.05: d2cdef1, d2cdef2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdeA (A:)
    nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
    ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpdiqkpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsavawsn
    ksdfacanafnn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdeB (B:)
    eadiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdl
    ssestvsrirtehfpltlesarpshtsqylcassenigtayeqyfgpgtrltvtedlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeq
    palndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdeC (C:)
    nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
    ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpdiqkpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsavawsn
    ksdfacanafnn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdeD (D:)
    eadiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdl
    ssestvsrirtehfpltlesarpshtsqylcassenigtayeqyfgpgtrltvtedlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeq
    palndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdeE (E:)
    nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
    ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpdiqkpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsavawsn
    ksdfacanafnn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdeF (F:)
    eadiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdl
    ssestvsrirtehfpltlesarpshtsqylcassenigtayeqyfgpgtrltvtedlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeq
    palndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad