PDB entry 2cd2

View 2cd2 on RCSB PDB site
Description: ligand induced conformational changes in the crystal structures of pneumocystis carinii dihydrofolate reductase complexes with folate and nadp+
Class: oxidoreductase
Keywords: oxido-reductase, folate, nadph, oxidoreductase
Deposited on 1999-03-15, released 2000-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Pneumocystis carinii [TaxId:4754]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16184 (0-205)
  Domains in SCOPe 2.07: d2cd2a_
• Heterogens: NAP, FOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cd2A (A:)
  mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
  twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
  fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
  vgtkvphgkinedgfdyefemwtrdl