PDB entry 2cd0

View 2cd0 on RCSB PDB site
Description: structure of human lambda-6 light chain dimer wil
Class: immune system
Keywords: immunoglobulin, bence-jones protein, lambda-6, immune system
Deposited on 1999-03-08, released 2000-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.289
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (bence-jones protein wil, a variable domain from lambda-6 type immunoglobulin light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB Z37375 (0-110)
      • conflict (2)
      • conflict (30)
      • conflict (34)
      • conflict (43)
      • conflict (49)
      • conflict (52-53)
      • conflict (66)
      • conflict (66)
      • conflict (95-96)
    Domains in SCOPe 2.08: d2cd0a_
  • Chain 'B':
    Compound: protein (bence-jones protein wil, a variable domain from lambda-6 type immunoglobulin light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB Z37375 (0-110)
      • conflict (2)
      • conflict (30)
      • conflict (34)
      • conflict (43)
      • conflict (49)
      • conflict (52-53)
      • conflict (66)
      • conflict (66)
      • conflict (95-96)
    Domains in SCOPe 2.08: d2cd0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cd0A (A:)
    nflltqphsvsespgktvtisctrssgsiannyvhwyqqrpgsspttvifeddhrpsgvp
    drfsgsvdtssnsasltisglktedeadyycqsydhnnqvfgggtkltvlg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cd0B (B:)
    nflltqphsvsespgktvtisctrssgsiannyvhwyqqrpgsspttvifeddhrpsgvp
    drfsgsvdtssnsasltisglktedeadyycqsydhnnqvfgggtkltvlg