PDB entry 2ccv

View 2ccv on RCSB PDB site
Description: structure of helix pomatia agglutinin with zinc and n-acetyl-alpha-d-galactoseamine (galnac)
Class: lectin
Keywords: lectin, snail, helix pomatia
Deposited on 2006-01-18, released 2006-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.1443
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: helix pomatia agglutinin
    Species: HELIX POMATIA [TaxId:6536]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2F1K8 (0-End)
      • conflict (10)
      • conflict (73)
    Domains in SCOPe 2.06: d2ccva1
  • Heterogens: ZN, A2G, GOL, ACT, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ccvA (A:)
    rvqsgkidcgddagwakvpsddpgrdntrelaknitfaspycrppvvllsitqldveqsq
    nlrviarlysvspsgfkascytwhntkvysmsiswisieny
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ccvA (A:)
    rvqsgkidcgddagwakvpsddpgrdntrelaknitfaspycrppvvllsitqldveqsq
    nlrviarlysvspsgfkascytwhntkvysmsiswisie