PDB entry 2ccq

View 2ccq on RCSB PDB site
Description: the pub domain functions as a p97 binding module in human peptide n-glycanase.
Class: glycoprotein
Keywords: glycoprotein, glycanase homolog
Deposited on 2006-01-17, released 2006-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.1932
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: peptide n-glycanase homolog
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BVR8 (0-98)
  Domains in SCOPe 2.07: d2ccqa1
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ccqA (A:)
  gsaspavaelcqntpetfleaskllltyadnilrnpndekyrsirigntafstrllpvrg
  aveclfemgfeegethlifpkkasveqlqkirdliaier