PDB entry 2ccp

View 2ccp on RCSB PDB site
Description: x-ray structures of recombinant yeast cytochrome c peroxidase and three heme-cleft mutants prepared by site-directed mutagenesis
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1990-02-28, released 1991-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.147
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yeast cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (Start-295)
      • variant (54)
      • variant (153)
      • engineered mutation (236)
    Domains in SCOPe 2.06: d2ccpa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ccpA (A:)
    mittplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwd
    khdntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqe
    mqgpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalg
    kthlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptnysl
    iqdpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ccpA (A:)
    tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhd
    ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
    pkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkth
    lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptnysliqd
    pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl