PDB entry 2ccl

View 2ccl on RCSB PDB site
Description: the s45a, t46a mutant of the type I cohesin-dockerin complex from the cellulosome of clostridium thermocellum
Class: cell adhesion
Keywords: cell adhesion, cohesin-dockerin complex, cellulosome, cohesin, dockerin, clostridium thermocellum, scaffolding, cellulose degradation, hydrolase, glycosidase
Deposited on 2006-01-16, released 2007-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulosomal scaffolding protein a
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CCL (150-End)
    • Uniprot Q06851 (Start-149)
    Domains in SCOPe 2.06: d2ccla2, d2ccla3
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase y
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CCL
      • engineered mutation (48-49)
    • Uniprot P51584 (1-62)
    Domains in SCOPe 2.06: d2cclb1
  • Chain 'C':
    Compound: cellulosomal scaffolding protein a
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CCL (150-End)
    • Uniprot Q06851 (Start-149)
    Domains in SCOPe 2.06: d2cclc2, d2cclc3
  • Chain 'D':
    Compound: endo-1,4-beta-xylanase y
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CCL
      • engineered mutation (48-49)
    • Uniprot P51584 (1-62)
    Domains in SCOPe 2.06: d2ccld_
  • Heterogens: PO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cclA (A:)
    masdgvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdii
    vdpnptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfde
    vggfadndlveqkvsfidggvnvgnatptklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cclA (A:)
    gvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpn
    ptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggf
    adndlveqkvsfidggvnvgnatptkleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cclB (B:)
    mvllgdvngdgtinstdltmlkrsvlraitltddakaradvdkngsinaadvlllsryll
    rvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cclB (B:)
    vllgdvngdgtinstdltmlkrsvlraitltddakaradvdkngsinaadvlllsryllr
    vi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cclC (C:)
    masdgvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdii
    vdpnptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfde
    vggfadndlveqkvsfidggvnvgnatptklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cclC (C:)
    gvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpn
    ptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggf
    adndlveqkvsfidggvnvgnatptkleh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cclD (D:)
    mvllgdvngdgtinstdltmlkrsvlraitltddakaradvdkngsinaadvlllsryll
    rvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cclD (D:)
    vllgdvngdgtinstdltmlkrsvlraitltddakaradvdkngsinaadvlllsryllr
    vi