PDB entry 2ccd

View 2ccd on RCSB PDB site
Description: crystal structure of the catalase-peroxidase (katg) and s315t mutant from mycobacterium tuberculosis
Class: oxidoreductase
Keywords: oxidoreductase, katg, hydrogen peroxide, iron, metal-binding
Deposited on 2006-01-16, released 2006-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.232
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxidase/catalase t
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08129 (Start-739)
      • engineered mutation (314)
    Domains in SCOPe 2.07: d2ccda1, d2ccda2
  • Chain 'B':
    Compound: peroxidase/catalase t
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08129 (Start-739)
      • engineered mutation (314)
    Domains in SCOPe 2.07: d2ccdb1, d2ccdb2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ccdA (A:)
    mpeqhppitetttgaasngcpvvghmkypvegggnqdwwpnrlnlkvlhqnpavadpmga
    afdyaaevatidvdaltrdieevmttsqpwwpadyghygplfirmawhaagtyrihdgrg
    gagggmqrfaplnswpdnasldkarrllwpvkkkygkklswadlivfagncalesmgfkt
    fgfgfgrvdqwepdevywgkeatwlgderysgkrdlenplaavqmgliyvnpegpngnpd
    pmaaavdiretfrrmamndvetaalivgghtfgkthgagpadlvgpepeaapleqmglgw
    kssygtgtgkdaittgievvwtntptkwdnsfleilygyeweltkspagawqytakdgag
    agtipdpfggpgrsptmlatdlslrvdpiyeritrrwlehpeeladefakawyklihrdm
    gpvarylgplvpkqtllwqdpvpavshdlvgeaeiaslksqirasgltvsqlvstawaaa
    ssfrgsdkrgganggrirlqpqvgwevndpdgdlrkvirtleeiqesfnsaapgnikvsf
    adlvvlggcaaiekaakaaghnitvpftpgrtdasqeqtdvesfavlepkadgfrnylgk
    gnplpaeymlldkanlltlsapemtvlvgglrvlganykrlplgvfteasesltndffvn
    lldmgitwepspaddgtyqgkdgsgkvkwtgsrvdlvfgsnselralvevygaddaqpkf
    vqdfvaawdkvmnldrfdvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ccdA (A:)
    mkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieevmt
    tsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpdnasldkar
    rllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeatwl
    gderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndvetaal
    ivgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaittgievvwtntp
    tkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdlslr
    vdpiyeritrrwlehpeeladefakawyklihrdmgpvarylgplvpkqtllwqdpvpav
    shdlvgeaeiaslksqirasgltvsqlvstawaaassfrgsdkrgganggrirlqpqvgw
    evndpdgdlrkvirtleeiqesfnsaapgnikvsfadlvvlggcaaiekaakaaghnitv
    pftpgrtdasqeqtdvesfavlepkadgfrnylgkgnplpaeymlldkanlltlsapemt
    vlvgglrvlganykrlplgvfteasesltndffvnlldmgitwepspaddgtyqgkdgsg
    kvkwtgsrvdlvfgsnselralvevygaddaqpkfvqdfvaawdkvmnldrfdvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ccdB (B:)
    mpeqhppitetttgaasngcpvvghmkypvegggnqdwwpnrlnlkvlhqnpavadpmga
    afdyaaevatidvdaltrdieevmttsqpwwpadyghygplfirmawhaagtyrihdgrg
    gagggmqrfaplnswpdnasldkarrllwpvkkkygkklswadlivfagncalesmgfkt
    fgfgfgrvdqwepdevywgkeatwlgderysgkrdlenplaavqmgliyvnpegpngnpd
    pmaaavdiretfrrmamndvetaalivgghtfgkthgagpadlvgpepeaapleqmglgw
    kssygtgtgkdaittgievvwtntptkwdnsfleilygyeweltkspagawqytakdgag
    agtipdpfggpgrsptmlatdlslrvdpiyeritrrwlehpeeladefakawyklihrdm
    gpvarylgplvpkqtllwqdpvpavshdlvgeaeiaslksqirasgltvsqlvstawaaa
    ssfrgsdkrgganggrirlqpqvgwevndpdgdlrkvirtleeiqesfnsaapgnikvsf
    adlvvlggcaaiekaakaaghnitvpftpgrtdasqeqtdvesfavlepkadgfrnylgk
    gnplpaeymlldkanlltlsapemtvlvgglrvlganykrlplgvfteasesltndffvn
    lldmgitwepspaddgtyqgkdgsgkvkwtgsrvdlvfgsnselralvevygaddaqpkf
    vqdfvaawdkvmnldrfdvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ccdB (B:)
    mkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieevmt
    tsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpdnasldkar
    rllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeatwl
    gderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndvetaal
    ivgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaittgievvwtntp
    tkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdlslr
    vdpiyeritrrwlehpeeladefakawyklihrdmgpvarylgplvpkqtllwqdpvpav
    shdlvgeaeiaslksqirasgltvsqlvstawaaassfrgsdkrgganggrirlqpqvgw
    evndpdgdlrkvirtleeiqesfnsaapgnikvsfadlvvlggcaaiekaakaaghnitv
    pftpgrtdasqeqtdvesfavlepkadgfrnylgkgnplpaeymlldkanlltlsapemt
    vlvgglrvlganykrlplgvfteasesltndffvnlldmgitwepspaddgtyqgkdgsg
    kvkwtgsrvdlvfgsnselralvevygaddaqpkfvqdfvaawdkvmnldrfdvr