PDB entry 2cca

View 2cca on RCSB PDB site
Description: Crystal structure of the catalase-peroxidase (KatG) and S315T mutant from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: oxidoreductase, catalase-peroxidase, katg, heme, peroxidase, hydrogen peroxide, iron, metal-binding
Deposited on 2006-01-16, released 2006-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxidase/catalase t
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ccaa1, d2ccaa2
  • Chain 'B':
    Compound: peroxidase/catalase t
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ccab1, d2ccab2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ccaA (A:)
    mpeqhppitetttgaasngcpvvghmkypvegggnqdwwpnrlnlkvlhqnpavadpmga
    afdyaaevatidvdaltrdieevmttsqpwwpadyghygplfirmawhaagtyrihdgrg
    gagggmqrfaplnswpdnasldkarrllwpvkkkygkklswadlivfagncalesmgfkt
    fgfgfgrvdqwepdevywgkeatwlgderysgkrdlenplaavqmgliyvnpegpngnpd
    pmaaavdiretfrrmamndvetaalivgghtfgkthgagpadlvgpepeaapleqmglgw
    kssygtgtgkdaitsgievvwtntptkwdnsfleilygyeweltkspagawqytakdgag
    agtipdpfggpgrsptmlatdlslrvdpiyeritrrwlehpeeladefakawyklihrdm
    gpvarylgplvpkqtllwqdpvpavshdlvgeaeiaslksqirasgltvsqlvstawaaa
    ssfrgsdkrgganggrirlqpqvgwevndpdgdlrkvirtleeiqesfnsaapgnikvsf
    adlvvlggcaaiekaakaaghnitvpftpgrtdasqeqtdvesfavlepkadgfrnylgk
    gnplpaeymlldkanlltlsapemtvlvgglrvlganykrlplgvfteasesltndffvn
    lldmgitwepspaddgtyqgkdgsgkvkwtgsrvdlvfgsnselralvevygaddaqpkf
    vqdfvaawdkvmnldrfdvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ccaA (A:)
    mkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieevmt
    tsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpdnasldkar
    rllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeatwl
    gderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndvetaal
    ivgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaitsgievvwtntp
    tkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdlslr
    vdpiyeritrrwlehpeeladefakawyklihrdmgpvarylgplvpkqtllwqdpvpav
    shdlvgeaeiaslksqirasgltvsqlvstawaaassfrgsdkrgganggrirlqpqvgw
    evndpdgdlrkvirtleeiqesfnsaapgnikvsfadlvvlggcaaiekaakaaghnitv
    pftpgrtdasqeqtdvesfavlepkadgfrnylgkgnplpaeymlldkanlltlsapemt
    vlvgglrvlganykrlplgvfteasesltndffvnlldmgitwepspaddgtyqgkdgsg
    kvkwtgsrvdlvfgsnselralvevygaddaqpkfvqdfvaawdkvmnldrfdvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ccaB (B:)
    mpeqhppitetttgaasngcpvvghmkypvegggnqdwwpnrlnlkvlhqnpavadpmga
    afdyaaevatidvdaltrdieevmttsqpwwpadyghygplfirmawhaagtyrihdgrg
    gagggmqrfaplnswpdnasldkarrllwpvkkkygkklswadlivfagncalesmgfkt
    fgfgfgrvdqwepdevywgkeatwlgderysgkrdlenplaavqmgliyvnpegpngnpd
    pmaaavdiretfrrmamndvetaalivgghtfgkthgagpadlvgpepeaapleqmglgw
    kssygtgtgkdaitsgievvwtntptkwdnsfleilygyeweltkspagawqytakdgag
    agtipdpfggpgrsptmlatdlslrvdpiyeritrrwlehpeeladefakawyklihrdm
    gpvarylgplvpkqtllwqdpvpavshdlvgeaeiaslksqirasgltvsqlvstawaaa
    ssfrgsdkrgganggrirlqpqvgwevndpdgdlrkvirtleeiqesfnsaapgnikvsf
    adlvvlggcaaiekaakaaghnitvpftpgrtdasqeqtdvesfavlepkadgfrnylgk
    gnplpaeymlldkanlltlsapemtvlvgglrvlganykrlplgvfteasesltndffvn
    lldmgitwepspaddgtyqgkdgsgkvkwtgsrvdlvfgsnselralvevygaddaqpkf
    vqdfvaawdkvmnldrfdvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ccaB (B:)
    mkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieevmt
    tsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpdnasldkar
    rllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeatwl
    gderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndvetaal
    ivgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaitsgievvwtntp
    tkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdlslr
    vdpiyeritrrwlehpeeladefakawyklihrdmgpvarylgplvpkqtllwqdpvpav
    shdlvgeaeiaslksqirasgltvsqlvstawaaassfrgsdkrgganggrirlqpqvgw
    evndpdgdlrkvirtleeiqesfnsaapgnikvsfadlvvlggcaaiekaakaaghnitv
    pftpgrtdasqeqtdvesfavlepkadgfrnylgkgnplpaeymlldkanlltlsapemt
    vlvgglrvlganykrlplgvfteasesltndffvnlldmgitwepspaddgtyqgkdgsg
    kvkwtgsrvdlvfgsnselralvevygaddaqpkfvqdfvaawdkvmnldrfdvr