PDB entry 2cc8

View 2cc8 on RCSB PDB site
Description: complexes of dodecin with flavin and flavin-like ligands
Class: flavoprotein
Keywords: flavoprotein, flavin, flavin-like ligands
Deposited on 2006-01-13, released 2006-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vng1446h
    Species: HALOBACTERIUM SALINARUM [TaxId:478009]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cc8a_
  • Heterogens: MG, NA, CL, RBF, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cc8A (A:)
    mvfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgveigaveertyqtevqv
    afeldgsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cc8A (A:)
    vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgveigaveertyqtevqva
    feld