PDB entry 2cbz

View 2cbz on RCSB PDB site
Description: structure of the human multidrug resistance protein 1 nucleotide binding domain 1
Class: transport
Keywords: abc proteins, mrp1/abcc1, nucleotide-binding domain, ATP-binding, hydrolysis, transport
Deposited on 2006-01-10, released 2006-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.161
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: multidrug resistance-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2CBZ (231-End)
    • Uniprot P33527 (1-230)
    Domains in SCOPe 2.06: d2cbza1, d2cbza2
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cbzA (A:)
    mnsitvrnatftwarsdpptlngitfsipegalvavvgqvgcgkssllsallaemdkveg
    hvaikgsvayvpqqawiqndslrenilfgcqleepyyrsviqacallpdleilpsgdrte
    igekgvnlsggqkqrvslaravysnadiylfddplsavdahvgkhifenvigpkgmlknk
    trilvthsmsylpqvdviivmsggkisemgsyqellardgafaeflrtyashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbzA (A:)
    nsitvrnatftwarsdpptlngitfsipegalvavvgqvgcgkssllsallaemdkvegh
    vaikgsvayvpqqawiqndslrenilfgcqleepyyrsviqacallpdleilpsgdrtei
    gekgvnlsggqkqrvslaravysnadiylfddplsavdahvgkhifenvigpkgmlknkt
    rilvthsmsylpqvdviivmsggkisemgsyqellardgafaeflrtyash