PDB entry 2cby

View 2cby on RCSB PDB site
Description: Crystal structure of the ATP-dependent Clp Protease proteolytic subunit 1 (ClpP1) from Mycobacterium tuberculosis
Class: hydrolase
Keywords: serine protease, clp protease, proteolytic subunit, endopeptidase, mycobacterium tuberculosis, ATP-dependent protease, hydrolase
Deposited on 2006-01-10, released 2006-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cbya1
  • Chain 'B':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cbyb_
  • Chain 'C':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cbyc_
  • Chain 'D':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cbyd_
  • Chain 'E':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cbye_
  • Chain 'F':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cbyf_
  • Chain 'G':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cbyg_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cbyA (A:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbyA (A:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cbyB (B:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbyB (B:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitrah
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cbyC (C:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbyC (C:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cbyD (D:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbyD (D:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitrahv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2cbyE (E:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbyE (E:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitra
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2cbyF (F:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbyF (F:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitrah
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2cbyG (G:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbyG (G:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
    vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit