PDB entry 2cbx

View 2cbx on RCSB PDB site
Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with beta-d-erythrofuranosyl-adenosine
Class: transferase
Keywords: fluorinase,5'-fluorodeoxyadenosine synthase,fla,inhibitor, aza,streptomyces cattleya,sam analogue,transferase
Deposited on 2006-01-09, released 2007-03-06
The last revision prior to the SCOP 1.73 freeze date was dated 2007-03-06, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: Streptomyces cattleya
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cbxa1, d2cbxa2
  • Chain 'B':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: Streptomyces cattleya
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cbxb1, d2cbxb2
  • Chain 'C':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: Streptomyces cattleya
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cbxc1, d2cbxc2
  • Heterogens: CC5, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cbxA (A:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbxA (A:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cbxB (B:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbxB (B:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cbxC (C:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbxC (C:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea