PDB entry 2cbs

View 2cbs on RCSB PDB site
Description: cellular retinoic acid binding protein II in complex with a synthetic retinoic acid (ro-13 6307)
Class: transport protein
Keywords: retinoic-acid transport, transport protein
Deposited on 1999-02-22, released 1999-12-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (crabp-II)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2cbsa_
  • Heterogens: R13, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cbsA (A:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
    ltmtaddvvctrvyvre