PDB entry 2cbp

View 2cbp on RCSB PDB site
Description: cucumber basic protein, a blue copper protein
Deposited on 1996-03-16, released 1997-04-21
The last revision prior to the SCOP 1.55 freeze date was dated 1997-04-21, with a file datestamp of 1997-04-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.141
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d2cbp__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cbp_ (-)
  avyvvggsggwtfnteswpkgkrfragdillfnynpsmhnvvvvnqggfstcntpagakv
  ytsgrdqiklpkgqsyficnfpghcqsgmkiavnal