PDB entry 2cbp

View 2cbp on RCSB PDB site
Description: cucumber basic protein, a blue copper protein
Class: electron transport
Keywords: electron transport, phytocyanin, type 1 copper protein
Deposited on 1996-03-16, released 1997-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.141
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cucumber basic protein
    Species: Cucumis sativus [TaxId:3659]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00303 (0-95)
      • insertion (36)
    Domains in SCOPe 2.08: d2cbpa_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cbpA (A:)
    avyvvggsggwtfnteswpkgkrfragdillfnynpsmhnvvvvnqggfstcntpagakv
    ytsgrdqiklpkgqsyficnfpghcqsgmkiavnal