PDB entry 2cbo

View 2cbo on RCSB PDB site
Description: crystal structure of the neocarzinostatin 3tes24 mutant bound to testosterone hemisuccinate.
Class: antibiotic
Keywords: antibiotic, phage-display, hapten binding, neocarzinostatin, antimicrobial, DNA-binding
Deposited on 2006-01-06, released 2006-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neocarzinostatin
    Species: STREPTOMYCES CARZINOSTATICUS [TaxId:1897]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3R9 (0-112)
      • engineered mutation (32)
      • engineered mutation (34)
      • engineered mutation (36)
      • engineered mutation (38)
      • engineered mutation (44)
      • engineered mutation (46)
      • engineered mutation (51)
    • PDB 2CBO (113-114)
    Domains in SCOPe 2.07: d2cboa_
  • Heterogens: SO4, TH2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cboA (A:)
    aaptatvtpssglsdgtvvkvagaglqagtaywvaqwarvdtgvwaynpadnssvtadan
    gsastsltvrrsfegflfdgtrwgtvdcttaacqvglsdaagngpegvaisfnhh