PDB entry 2cbn

View 2cbn on RCSB PDB site
Description: Crystal structure of ZipD from Escherichia coli
Class: hydrolase
Keywords: phosphodiesterase beta lactamase trnase z, hydrolase, metal- binding, endonuclease, tRNA processing
Deposited on 2006-01-06, released 2006-02-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.23
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease z
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CBN (0-0)
      • conflict (2)
    • Uniprot P0A8V0 (1-305)
    Domains in SCOPe 2.05: d2cbna1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cbnA (A:)
    amnliflgtsagvptrtrnvtaillnlqhptqsglwlfdcgegtqhqllhtafnpgkldk
    ifishlhgdhlfglpgllcsrsmsgiiqpltiygpqgirefvetalrisgswtdypleiv
    eigageilddglrkvtayplehplecygyrieehdapgalnaqalkaagvppgplfqelk
    agktitledgrqingadylaapvpgkalaifgdtgpcdaaldlakgvdvmvheatlditm
    eakansrghsstrqaatlareagvgkliithvssryddkgcqhllrecrsifpateland
    ftvfnv