PDB entry 2cbj

View 2cbj on RCSB PDB site
Description: structure of the clostridium perfringens nagj family 84 glycoside hydrolase, a homologue of human o-glcnacase in complex with pugnac
Class: hydrolase
Keywords: o-glcnac, family 84 glycoside hydrolases, glycoside hydrolase, hyaluronidases, carbohydrates, hydrolase
Deposited on 2006-01-05, released 2006-02-13
The last revision prior to the SCOP 1.75 freeze date was dated 2006-02-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.194
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyaluronidase
    Species: Clostridium perfringens
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8XL08 (Start-593)
      • conflict see remark 9 (165)
      • conflict see remark 9 (203)
      • conflict see remark 9 (213)
      • conflict see remark 9 (237)
      • conflict see remark 9 (248)
      • conflict see remark 9 (317)
    Domains in SCOP 1.75: d2cbja1, d2cbja2, d2cbja3
  • Chain 'B':
    Compound: hyaluronidase
    Species: Clostridium perfringens
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8XL08 (Start-593)
      • conflict see remark 9 (165)
      • conflict see remark 9 (203)
      • conflict see remark 9 (213)
      • conflict see remark 9 (237)
      • conflict see remark 9 (248)
      • conflict see remark 9 (317)
    Domains in SCOP 1.75: d2cbjb1, d2cbjb2, d2cbjb3
  • Heterogens: CL, OAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cbjA (A:)
    vgpktgeenqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltann
    ieinsendpnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgd
    gtfygvqtfkqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenkl
    ntyiyapkddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdag
    eedfnhlitkaeslydmgvrsfaiywddiqdksaakhaqvlnrfneefvkakgdvkplit
    vpteydtgamvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiynrn
    mavwwnypvtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswn
    mdnydydkawnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwn
    klsskedasalieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasld
    mivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbjA (A:)
    qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
    nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
    kqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenklntyiyapkd
    dpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdageedfnhlit
    kaeslydmgvrsfaiywddiqdksaakhaqvlnrfneefvkakgdvkplitvpteydtga
    mvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiynrnmavwwnypv
    tdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswnmdnydydka
    wnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwnklsskedas
    alieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasldmivaqlned
    teayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cbjB (B:)
    vgpktgeenqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltann
    ieinsendpnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgd
    gtfygvqtfkqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenkl
    ntyiyapkddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdag
    eedfnhlitkaeslydmgvrsfaiywddiqdksaakhaqvlnrfneefvkakgdvkplit
    vpteydtgamvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiynrn
    mavwwnypvtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswn
    mdnydydkawnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwn
    klsskedasalieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasld
    mivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbjB (B:)
    qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
    nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
    kqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenklntyiyapkd
    dpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdageedfnhlit
    kaeslydmgvrsfaiywddiqdksaakhaqvlnrfneefvkakgdvkplitvpteydtga
    mvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiynrnmavwwnypv
    tdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswnmdnydydka
    wnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwnklsskedas
    alieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasldmivaqlned
    teayesakeiaqnklntalssfavisekvaqsfiqealsfdltli