PDB entry 2cbi

View 2cbi on RCSB PDB site
Description: structure of the clostridium perfringens nagj family 84 glycoside hydrolase, a homologue of human o-glcnacase
Class: hydrolase
Keywords: o-glcnac, family 84 glycoside hydrolases, glycoside hydrolase, hyaluronidases, carbohydrates, hydrolase
Deposited on 2006-01-04, released 2006-02-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.16945
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyaluronidase
    Species: Clostridium perfringens
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8XL08 (Start-593)
      • conflict see remark 9 (165)
      • conflict see remark 9 (203)
      • conflict see remark 9 (213)
      • conflict see remark 9 (237)
      • conflict see remark 9 (248)
      • conflict see remark 9 (317)
    Domains in SCOP 1.73: d2cbia1, d2cbia2, d2cbia3
  • Chain 'B':
    Compound: hyaluronidase
    Species: Clostridium perfringens
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8XL08 (Start-593)
      • conflict see remark 9 (165)
      • conflict see remark 9 (203)
      • conflict see remark 9 (213)
      • conflict see remark 9 (237)
      • conflict see remark 9 (248)
      • conflict see remark 9 (317)
    Domains in SCOP 1.73: d2cbib1, d2cbib2, d2cbib3
  • Heterogens: SO4, CL, ZN, GBL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cbiA (A:)
    vgpktgeenqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltann
    ieinsendpnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgd
    gtfygvqtfkqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenkl
    ntyiyapkddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdag
    eedfnhlitkaeslydmgvrsfaiywddiqdksaakhaqvlnrfneefvkakgdvkplit
    vpteydtgamvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiynrn
    mavwwnypvtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswn
    mdnydydkawnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwn
    klsskedasalieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasld
    mivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbiA (A:)
    vlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendpn
    sttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtfk
    qlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenklntyiyapkdd
    pyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdageedfnhlitk
    aeslydmgvrsfaiywddiqdksaakhaqvlnrfneefvkakgdvkplitvpteydtgam
    vsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiynrnmavwwnypvt
    dyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswnmdnydydkaw
    nraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwnklsskedasa
    lieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasldmivaqlnedt
    eayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cbiB (B:)
    vgpktgeenqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltann
    ieinsendpnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgd
    gtfygvqtfkqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenkl
    ntyiyapkddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdag
    eedfnhlitkaeslydmgvrsfaiywddiqdksaakhaqvlnrfneefvkakgdvkplit
    vpteydtgamvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiynrn
    mavwwnypvtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswn
    mdnydydkawnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwn
    klsskedasalieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasld
    mivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cbiB (B:)
    vlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendpn
    sttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtfk
    qlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenklntyiyapkdd
    pyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdageedfnhlitk
    aeslydmgvrsfaiywddiqdksaakhaqvlnrfneefvkakgdvkplitvpteydtgam
    vsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiynrnmavwwnypvt
    dyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswnmdnydydkaw
    nraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwnklsskedasa
    lieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasldmivaqlnedt
    eayesakeiaqnklntalssfavisekvaqsfiqealsfdltli