PDB entry 2cbf

View 2cbf on RCSB PDB site
Description: the x-ray structure of a cobalamin biosynthetic enzyme, cobalt precorrin-4 methyltransferase, cbif, from bacillus megaterium, with the his-tag cleaved off
Class: methyltransferase
Keywords: precorrin-4 methyltransferase, methylase, cobalamin biosynthesis, methyltransferase
Deposited on 1998-05-01, released 1999-05-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.183
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cobalt-precorrin-4 transmethylase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: CBIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87696 (3-233)
      • conflict (168)
    Domains in SCOPe 2.05: d2cbfa_
  • Heterogens: SAH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cbfA (A:)
    gshmklyiigagpgdpdlitvkglkllqqadvvlyadslvsqdliakskpgaevlktagm
    hleemvgtmldrmregkmvvrvhtgdpamygaimeqmvllkregvdieivpgvtsvfaaa
    aaaeaeltipdltqtviltraegrtpvpefekltdlakhkctialflsstltkkvmkefi
    nagwsedtpvvvvykatwpdekivrttvkdlddamrtngirkqamilagwaldp