PDB entry 2cbf

View 2cbf on RCSB PDB site
Description: the x-ray structure of a cobalamin biosynthetic enzyme, cobalt precorrin-4 methyltransferase, cbif, from bacillus megaterium, with the his-tag cleaved off
Deposited on 1998-05-01, released 1999-05-11
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-11, with a file datestamp of 1999-05-10.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.183
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2cbf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cbf_ (-)
gshmklyiigagpgdpdlitvkglkllqqadvvlyadslvsqdliakskpgaevlktagm
hleemvgtmldrmregkmvvrvhtgdpamygaimeqmvllkregvdieivpgvtsvfaaa
aaaeaeltipdltqtviltraegrtpvpefekltdlakhkctialflsstltkkvmkefi
nagwsedtpvvvvykatwpdekivrttvkdlddamrtngirkqamilagwaldp