PDB entry 2cb3

View 2cb3 on RCSB PDB site
Description: crystal structure of peptidoglycan recognition protein-le in complex with tracheal cytotoxin (monomeric diaminopimelic acid-type peptidoglycan)
Class: immune system
Keywords: pgrp, tracheal cytotoxin, innate immunity, immune system
Deposited on 2005-12-29, released 2006-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.1985
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidoglycan-recognition protein-le
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CB3
      • engineered mutation (56)
    • Uniprot Q9VXN9
    Domains in SCOPe 2.08: d2cb3a1
  • Chain 'B':
    Compound: peptidoglycan-recognition protein-le
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CB3
      • engineered mutation (56)
    • Uniprot Q9VXN9
    Domains in SCOPe 2.08: d2cb3b_
  • Chain 'C':
    Compound: peptidoglycan-recognition protein-le
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CB3 (0-1)
      • engineered mutation (56)
    • Uniprot Q9VXN9 (2-End)
    Domains in SCOPe 2.08: d2cb3c_
  • Chain 'D':
    Compound: peptidoglycan-recognition protein-le
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CB3
      • engineered mutation (56)
    • Uniprot Q9VXN9
    Domains in SCOPe 2.08: d2cb3d_
  • Heterogens: GOL, MLD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cb3A (A:)
    ghelsaiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhi
    esrgwndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadaln
    mcrnllargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeeeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cb3A (A:)
    lsaiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhiesr
    gwndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadalnmcr
    nllargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cb3B (B:)
    ghelsaiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhi
    esrgwndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadaln
    mcrnllargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeeeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cb3B (B:)
    saiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhiesrg
    wndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadalnmcrn
    llargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cb3C (C:)
    ghelsaiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhi
    esrgwndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadaln
    mcrnllargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeeeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cb3C (C:)
    ghelsaiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhi
    esrgwndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadaln
    mcrnllargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cb3D (D:)
    ghelsaiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhi
    esrgwndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadaln
    mcrnllargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeeeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cb3D (D:)
    lsaiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhiesr
    gwndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadalnmcr
    nllargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeee