PDB entry 2cb2

View 2cb2 on RCSB PDB site
Description: sulfur oxygenase reductase from acidianus ambivalens
Class: oxidoreductase
Keywords: oxidoreductase, sulfur oxygenase reductase, mononuclear non-heme iron, biogeochemical sulfur cycle, extremophile, thermophilic, acidophilic, cysteine persulphide, icosatetramer, proto- organelle, nano-structure, compartmentalization, 2-his-1- carboxylate facial triad, archaea, metal-binding
Deposited on 2005-12-28, released 2006-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.183
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfur oxygenase reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CB2
    • Uniprot P29082 (1-End)
    Domains in SCOPe 2.06: d2cb2a1
  • Chain 'B':
    Compound: sulfur oxygenase reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CB2
    • Uniprot P29082 (1-End)
    Domains in SCOPe 2.06: d2cb2b_
  • Chain 'C':
    Compound: sulfur oxygenase reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CB2
    • Uniprot P29082 (1-End)
    Domains in SCOPe 2.06: d2cb2c_
  • Chain 'D':
    Compound: sulfur oxygenase reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CB2
    • Uniprot P29082 (1-End)
    Domains in SCOPe 2.06: d2cb2d_
  • Chain 'E':
    Compound: sulfur oxygenase reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CB2
    • Uniprot P29082 (1-End)
    Domains in SCOPe 2.06: d2cb2e_
  • Chain 'F':
    Compound: sulfur oxygenase reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CB2
    • Uniprot P29082 (1-End)
    Domains in SCOPe 2.06: d2cb2f_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cb2A (A:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylneqawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cb2A (A:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cb2B (B:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylneqawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cb2B (B:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cb2C (C:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylneqawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cb2C (C:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cb2D (D:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylneqawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cb2D (D:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2cb2E (E:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylneqawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cb2E (E:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2cb2F (F:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylneqawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cb2F (F:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne