PDB entry 2caz

View 2caz on RCSB PDB site
Description: ESCRT-I core
Class: protein transport
Keywords: protein transport, escrt, mvb, multivesicular bodies, endosome, lysosome, ph domain, protein sorting, vesicle trafficking, ubiquitin, phosphoinositide, ptdins3p, vps23, vps28, vps37, vps36, coiled coil, ubl conjugation pathway
Deposited on 2005-12-23, released 2006-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2caza1
  • Chain 'B':
    Compound: vacuolar protein sorting-associated protein vps28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cazb1
  • Chain 'C':
    Compound: protein srn2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CAZ
      • conflict (11)
      • conflict (14)
    • Uniprot Q99176
    Domains in SCOPe 2.07: d2cazc1
  • Chain 'D':
    Compound: suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CAZ
    • Uniprot P25604 (Start-81)
    Domains in SCOPe 2.07: d2cazd1
  • Chain 'E':
    Compound: vacuolar protein sorting-associated protein vps28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2caze1
  • Chain 'F':
    Compound: protein srn2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cazA (A:)
    mstshvddedvnsiavaktdglnqlynlvaqdyaltdtieclsrmlhrgtipldtfvkqg
    relarqqflvrwhiqritspls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cazA (A:)
    lnqlynlvaqdyaltdtieclsrmlhrgtipldtfvkqgrelarqqflvrwhiqritsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cazB (B:)
    mahhhhhhmqkhniklnqnqdisqlfhdevplfdnsitskdkevietlseiysivitldh
    vekaylkdsiddtqytntvdkllkqfkvylnsqnkeeinkhfqsieafcdtynitasnai
    trlergipitaehaistttsapsgdnkqssssdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cazB (B:)
    plfdnsitskdkevietlseiysivitldhvekaylkdsiddtqytntvdkllkqfkvyl
    nsqnkeeinkhfqsieafcdtynitasnaitrlergipita
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cazC (C:)
    myvaswqdyhsdfsekygdialkkkleqntkkldeessqletttrsidsaddldqfikny
    ldirtqyhlrreklatwdkqgnlky
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cazC (C:)
    sdfsekygdialkkkleqntkkldeessqletttrsidsaddldqfiknyldirtqyhlr
    rekla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cazD (D:)
    mstshvddedvnsiavaktdglnqlynlvaqdyaltdtieclsrmlhrgtipldtfvkqg
    relarqqflvrwhiqritspls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cazD (D:)
    lnqlynlvaqdyaltdtieclsrmlhrgtipldtfvkqgrelarqqflvrwhiqritspl
    s
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2cazE (E:)
    mahhhhhhmqkhniklnqnqdisqlfhdevplfdnsitskdkevietlseiysivitldh
    vekaylkdsiddtqytntvdkllkqfkvylnsqnkeeinkhfqsieafcdtynitasnai
    trlergipitaehaistttsapsgdnkqssssdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cazE (E:)
    vplfdnsitskdkevietlseiysivitldhvekaylkdsiddtqytntvdkllkqfkvy
    lnsqnkeeinkhfqsieafcdtynitasnaitrlergipita
    

  • Chain 'F':
    No sequence available.